Recombinant Bartonella henselae Beta- (1-->2)glucan export ATP-binding/permease protein NdvA (ndvA)

Shipped with Ice Packs
In Stock

Description

Overview of NdvA in Bacterial Systems

NdvA is an ATP-binding/permease protein involved in the export of cyclic β-(1→2)glucans, which are critical for bacterial biofilm formation, host-cell interaction, and osmotic adaptation. While no direct studies on Bartonella henselae NdvA were identified, homologous proteins in related species (e.g., Rhodopseudomonas palustris NdvA ) suggest conserved roles:

  • Function: Facilitates glucan transport across the inner membrane via ATP hydrolysis.

  • Structure: Comprises an ATP-binding domain (N-terminal) and a permease domain (C-terminal).

Role in Biofilm Formation

In Brucella spp., NdvA-like proteins contribute to biofilm formation by exporting cyclic glucans, which mediate bacterial aggregation and host-cell adhesion . Similar mechanisms may apply to B. henselae, given its reliance on adhesins like BadA for endothelial cell binding .

Interaction with Host Cells

While B. henselae BadA binds fibronectin and collagen via repetitive neck/stalk domains , NdvA’s glucan export activity could indirectly modulate host interactions by altering biofilm integrity or osmotic stress responses.

ATP-Binding and Permease Activity

Homologs of NdvA (e.g., in Rhizobium) require ATP hydrolysis for glucan transport, a feature likely conserved in B. henselae . Mutational studies in R. palustris show that disruptions in ATP-binding motifs abolish glucan export .

Research Gaps and Future Directions

  • No direct studies on B. henselae NdvA were identified in the provided sources.

  • Proposed Research:

    1. Structural Analysis: Cryo-EM or X-ray crystallography to resolve ATP-binding and permease domains.

    2. Functional Assays: Measure glucan export efficiency using fluorescently labeled substrates.

    3. Pathogenicity Studies: Knockout models to assess NdvA’s role in B. henselae virulence.

Comparison with Other Bartonella Adhesins

ProteinFunctionExpression SystemKey Domains
BadAHost-cell adhesion, VEGF inductionB. henselaeHead, repetitive neck/stalk
BafAAngiogenic factor, VEGFR2 activationE. coliPassenger domain
Pap31Fibronectin binding, heme acquisitionE. coliOuter membrane protein
NdvAGlucan export, biofilm formationE. coli (hypothesized)ATP-binding, permease

Technical Considerations for Recombinant Production

  • Codons: Optimize for E. coli to enhance yield .

  • Solubility: Use detergents or chaperones if inclusion bodies form .

  • Activity Assays: Monitor ATPase activity and glucan transport via HPLC or mass spectrometry .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery details.
Note: Our standard shipping method includes normal blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
ndvA; BH10210; Beta-(1-->2glucan export ATP-binding/permease protein NdvA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-595
Protein Length
full length protein
Species
Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) (Rochalimaea henselae)
Target Names
ndvA
Target Protein Sequence
MSLFRTYARVLTYLNKEKNASLLICSANVMLAIITIAEPILFGHVIDSIAEKSAIIPTLT IWVCFGISHILAYVLIARGADRLVHRRRLAVLTESFERIIAMPLIWHQQRGTSNALHILL RAVDSMATIWLDFMRQHLSTLVALFVLIPIAFNMNWRLSIVLVVLAIIYVLIARLVMRKT KDGQAAVECYHHNLFQHVSDSISNVSIVQSYNRIKEETSILHQHTNDLLKAQNPVLNWWA LASGLNRMASTISIVCVLLLGAFFVAKGQLRVGEVVSFVGFAQLMISRLDQMSNFINLTI SSQAKLQEFFAMEDSTFQSKEPENLPSLQNVKGAIQFHHVTYKFPNSSQGIFDISFEVKT GQTVAIVGPTGAGKTTLINLLQRIYDPTLGHISIDGINIRSVNRESLRKSLATVFQDAGL FNRTIHDNISIGRTTATNEELYEAAKIAAAHDFILKKTDRYNTMIGEQGSQLSGGEKQRL AIARAVLKNAPILILDEATSALDVETEARVKDALDCISHNRTTFIIAHRLSTVRNADLVL FLEQGHLIEKGSFQELIAKGGRFYKLLKAGSLAINQPTIETKDENVIPLHEAIAS
Uniprot No.

Target Background

Function
This protein is involved in beta-(1-->2)glucan export. Transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: bhe:BH10210

STRING: 283166.BH10210

Protein Families
ABC transporter superfamily, Beta-(1-->2)glucan exporter (TC 3.A.1.108.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of NdvA protein in Bartonella henselae?

NdvA functions as an ATP-binding cassette (ABC) transporter specifically responsible for the export of cyclic β-glucans (CβGs) across bacterial membranes into the periplasmic space. These polysaccharides play critical roles in bacterial interactions with host cells, particularly during infection processes. The protein utilizes ATP to translocate these complex molecules across the membrane barrier, with the CβGs being essential for establishing specific host-pathogen interactions in Rhizobiales, including B. henselae . The transport mechanism likely involves conformational changes in the protein structure upon ATP binding and hydrolysis, facilitating the movement of substrate across the membrane.

How does NdvA compare to similar transporters in other bacterial species?

NdvA in B. henselae shares significant structural and functional homology with other bacterial cyclic glucan transporters, particularly the Cgt from Brucella abortus (also a member of Rhizobiales) and NdvA proteins in Bradyrhizobium japonicum and Agrobacterium vitis . These proteins all function as ABC transporters for cyclic β-glucans, though with species-specific variations in substrate specificity and transport efficiency. Recent cryoelectron microscopy studies of Cgt from Brucella abortus have revealed four distinct conformational states during the transport cycle, including a substrate-bound structure with an unusual binding pocket at the cytoplasmic leaflet . These findings likely apply to the mechanistic understanding of B. henselae NdvA as well, given the conservation of functional domains across these related transporters.

What is the genetic organization of the ndvA gene in Bartonella henselae?

The ndvA gene in B. henselae encodes the Beta-(1-->2)glucan export ATP-binding/permease protein. Similar to other ABC transporters, the gene typically encodes both the nucleotide-binding domain (NBD) that binds and hydrolyzes ATP, and the transmembrane domain (TMD) that forms the substrate translocation pathway. While the specific genetic organization isn't detailed in the provided search results, comparative analysis with related bacterial species suggests the gene likely contains conserved Walker A and Walker B motifs characteristic of ATP-binding proteins, along with signature ABC transporter sequences. The gene may be part of an operon that includes additional genes involved in cyclic β-glucan synthesis and regulation, similar to what has been observed in related bacterial species.

Why are cyclic β-glucans important for Bartonella henselae pathogenesis?

Cyclic β-glucans (CβGs) exported by NdvA are critical virulence factors that facilitate bacterial survival during infection processes. These polysaccharides contribute to:

  • Host cell interaction and adhesion

  • Evasion of host immune responses

  • Adaptation to the host environment

  • Formation of protective structures against environmental stresses

In related Rhizobiales like Brucella, CβGs have been demonstrated to be essential for host interaction and successful infection . The translocation of these polysaccharides into the periplasmic space provides bacterial cells with structural and functional advantages during colonization of host tissues. Mutations affecting CβG production or export typically result in attenuated virulence, underscoring their importance in bacterial pathogenesis.

What are the structural characteristics of the NdvA protein?

Based on the structural analysis of related ABC transporters like Cgt from Brucella abortus, NdvA likely consists of:

  • Transmembrane domains (TMDs): Typically containing multiple membrane-spanning α-helices that form the substrate translocation pathway

  • Nucleotide-binding domains (NBDs): Responsible for ATP binding and hydrolysis

  • Substrate-binding pocket: Located near the cytoplasmic leaflet for recognizing cyclic β-glucans

The protein undergoes conformational changes during the transport cycle, transitioning between at least four distinct states as observed in Cgt: resting, substrate-bound, pre-hydrolysis (ATP-bound), and post-hydrolysis states . These structural transitions are essential for the directional transport of CβGs across the membrane. The binding pocket for polysaccharide substrates is unusually positioned at the height of the cytoplasmic leaflet, a feature that may be conserved in NdvA .

What experimental approaches are most effective for studying the substrate specificity of recombinant NdvA?

To investigate substrate specificity of recombinant NdvA, researchers should employ a multi-faceted approach:

  • In vitro transport assays: Using purified recombinant NdvA reconstituted in liposomes or nanodiscs with radiolabeled or fluorescently-tagged cyclic β-glucans of varying sizes and compositions. Measure transport rates using scintillation counting or fluorescence techniques.

  • Binding affinity measurements: Employ surface plasmon resonance (SPR), isothermal titration calorimetry (ITC), or microscale thermophoresis (MST) to determine binding constants for different substrates.

  • Competitive inhibition studies: Test substrate preference by competitive binding assays with structurally similar molecules.

  • Site-directed mutagenesis: Modify predicted substrate-binding residues and assess the impact on transport function and substrate recognition.

  • Structural approaches: Use cryoelectron microscopy as employed for Brucella Cgt to visualize substrate-bound conformations . This approach revealed an unusual binding pocket at the cytoplasmic leaflet in Cgt, which might be conserved in NdvA.

A combined approach integrating functional assays with structural studies provides the most comprehensive understanding of substrate specificity determinants in this ABC transporter.

How can researchers effectively distinguish between conformational states of NdvA during the transport cycle?

Distinguishing between conformational states of NdvA requires sophisticated biophysical techniques:

  • Cryoelectron microscopy (cryo-EM): As demonstrated with Brucella Cgt, single-particle cryo-EM can effectively capture different conformational states during the transport cycle . This technique revealed four distinct conformations: resting, substrate-bound, ATP-bound, and post-hydrolysis states.

  • Double electron-electron resonance (DEER) spectroscopy: By introducing spin labels at strategic positions on the protein, researchers can measure distances between domains during conformational changes with nanometer precision.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach identifies regions of altered solvent accessibility during conformational transitions.

  • Förster resonance energy transfer (FRET): Using fluorescent probes on different domains to detect distance changes during the transport cycle.

  • State-specific inhibitors or nucleotide analogs: ADP-vanadate trapping, for example, can stabilize the post-hydrolysis state for structural analysis, as used in the Cgt study .

  • Time-resolved spectroscopy: Track conformational changes in real-time following ATP addition.

Combining these approaches with transport activity assays creates a comprehensive picture of structure-function relationships during the transport cycle.

What are the optimal conditions for expressing high yields of properly folded recombinant NdvA protein?

Based on successful expression strategies for bacterial membrane proteins, including the related 17-kDa protein from B. henselae :

Expression System Selection:

  • Prokaryotic systems: E. coli BL21(DE3) or C43(DE3) strains (specialized for membrane proteins)

  • Cell-free expression systems for toxic membrane proteins

Vector Design:

  • Include a histidine tag for purification (as used for B. henselae 17-kDa protein)

  • Consider fusion partners like MBP or SUMO to enhance solubility

  • Use inducible promoters like T7 with tight regulation

Culture Conditions:

  • Lower induction temperatures (16-25°C) to slow expression and facilitate proper folding

  • Induce at mid-log phase (OD600 0.6-0.8)

  • Extended induction periods (12-24 hours) at lower temperatures

  • Supplement with 0.5-1% glucose to prevent leaky expression

Membrane Extraction and Purification:

  • Use mild detergents (DDM, LMNG) for extraction

  • Employ nickel-agarose column chromatography for His-tagged proteins

  • Consider size exclusion chromatography as a final polishing step

Protein Quality Assessment:

  • Size exclusion chromatography to verify monodispersity

  • ATPase activity assays to confirm functionality

  • Circular dichroism to assess secondary structure

  • Electron microscopy to verify structural integrity

Optimizing these conditions can yield approximately 3 mg of purified membrane protein per 100 mL of bacterial culture, similar to what was achieved for the B. henselae 17-kDa protein .

How does ATP hydrolysis couple to substrate translocation in the NdvA transport mechanism?

The coupling mechanism between ATP hydrolysis and substrate translocation in NdvA likely follows these sequential steps, based on what is known about related ABC transporters including Cgt from Brucella :

  • Substrate binding: Cyclic β-glucans bind to the substrate pocket located at the cytoplasmic leaflet of the transmembrane domains, inducing conformational changes that are transmitted to the nucleotide-binding domains (NBDs).

  • ATP binding: Two ATP molecules bind at the interface of the NBD dimer, causing the NBDs to close together.

  • Power stroke: ATP binding and subsequent NBD closure triggers conformational changes in the transmembrane domains, reorienting the substrate-binding site from an inward-facing to an outward-facing conformation.

  • Substrate release: The reduced affinity of the outward-facing conformation for the substrate facilitates release into the periplasmic space.

  • ATP hydrolysis: Hydrolysis of ATP weakens the NBD dimer interface, preparing the transporter for reset.

  • ADP and Pi release: The release of hydrolysis products allows the transporter to return to its resting state, completing the cycle.

The ADP-vanadate models of Cgt suggest an alternative mechanism for substrate release compared to some other ABC transporters , which may apply to NdvA as well. This coupling mechanism ensures unidirectional transport of cyclic β-glucans against their concentration gradient, a process essential for bacterial virulence.

What genomic approaches can be used to study the regulation of ndvA expression during infection?

To understand ndvA regulation during infection, researchers can employ these genomic approaches:

  • RNA-Seq analysis: Compare transcriptome profiles of Bartonella henselae under different conditions (in vitro culture vs. infection models) to identify infection-specific expression patterns of ndvA and co-regulated genes.

  • ChIP-Seq: Identify transcription factors binding to the ndvA promoter region during infection by chromatin immunoprecipitation followed by sequencing.

  • 5' RACE (Rapid Amplification of cDNA Ends): Precisely map the transcription start site of ndvA to identify core promoter elements.

  • Promoter reporter fusions: Create fusions of the ndvA promoter with reporter genes (GFP, luciferase) to monitor expression in real-time during infection processes.

  • DNase-Seq and ATAC-Seq: Identify accessible chromatin regions near ndvA that may function as regulatory elements.

  • Genetic knockout studies: Create targeted mutations in putative regulatory genes and assess the impact on ndvA expression.

  • Single-cell RNA-Seq: Examine cell-to-cell variability in ndvA expression during infection to identify potential heterogeneity in bacterial populations.

  • Ribosome profiling: Assess translational efficiency of ndvA mRNA during different stages of infection.

These approaches can be combined with environmental stimuli testing (pH, temperature, nutrient limitation, host cell contact) to identify infection-relevant signals that modulate ndvA expression.

What are the optimal protocols for recombinant expression and purification of NdvA protein?

Based on successful strategies for expressing bacterial membrane proteins, including the B. henselae 17-kDa protein , here is a comprehensive protocol:

Cloning:

  • Amplify the ndvA gene from B. henselae genomic DNA using high-fidelity polymerase

  • Clone into an expression vector with 6×His tag (e.g., pET vector system)

  • Verify correct sequence insertion by Sanger sequencing

Expression:

  • Transform E. coli BL21(DE3) with the recombinant construct

  • Grow in LB medium with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8

  • Reduce temperature to 18°C, induce with 0.5 mM IPTG

  • Continue expression for 16-20 hours

Membrane Fraction Preparation:

  • Harvest cells by centrifugation (5,000 × g, 15 min, 4°C)

  • Resuspend in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSF)

  • Disrupt cells by sonication or high-pressure homogenization

  • Remove cell debris by centrifugation (10,000 × g, 20 min, 4°C)

  • Ultracentrifuge supernatant (100,000 × g, 1 h, 4°C) to collect membrane fraction

Solubilization and Purification:

  • Solubilize membrane proteins with 1% n-dodecyl-β-D-maltoside (DDM) for 1 hour at 4°C

  • Remove insoluble material by ultracentrifugation (100,000 × g, 30 min, 4°C)

  • Perform nickel-agarose column chromatography:

    • Load solubilized protein onto equilibrated Ni-NTA column

    • Wash with 20 mM imidazole to remove non-specific binding

    • Elute with 250 mM imidazole gradient

  • Perform size exclusion chromatography in buffer containing 0.05% DDM

Quality Control:

  • Assess purity by SDS-PAGE and Western blot

  • Verify identity by mass spectrometry

  • Test ATPase activity to confirm functionality

  • Evaluate oligomeric state by size exclusion chromatography

Using this protocol, protein yields of approximately 2-3 mg per 100 mL of bacterial culture can be expected, similar to what was achieved for the B. henselae 17-kDa protein (2.9 mg/100 mL) .

How can researchers effectively assess the functional activity of recombinant NdvA protein?

To comprehensively evaluate NdvA functionality, employ these complementary approaches:

1. ATPase Activity Assays:

  • Measure inorganic phosphate release using malachite green or EnzChek Phosphate Assay

  • Determine kinetic parameters (Km, Vmax) for ATP hydrolysis

  • Test ATPase stimulation by potential substrate molecules

  • Assess the effects of known ABC transporter inhibitors (vanadate, beryllium fluoride)

2. Substrate Transport Assays:

  • Reconstitute purified NdvA into proteoliposomes

  • Load fluorescently-labeled or radiolabeled cyclic β-glucans inside or outside vesicles

  • Measure time-dependent substrate translocation

  • Calculate transport rates and efficiency

3. Binding Assays:

  • Use surface plasmon resonance (SPR) to determine binding constants for ATP and substrates

  • Employ isothermal titration calorimetry (ITC) to measure thermodynamic parameters of binding

  • Perform microscale thermophoresis (MST) to assess binding under near-native conditions

4. Conformational Change Analysis:

  • Monitor ATP-induced conformational changes using intrinsic tryptophan fluorescence

  • Apply limited proteolysis to identify protected regions in different functional states

  • Perform hydrogen-deuterium exchange mass spectrometry to detect structural rearrangements

5. Complementation Studies:

  • Express recombinant NdvA in ndvA-deficient bacterial strains

  • Assess restoration of cyclic β-glucan export

  • Measure recovery of phenotypes related to host cell interaction and virulence

A functional NdvA protein should demonstrate ATP hydrolysis activity, undergo conformational changes upon nucleotide binding, and facilitate the transport of cyclic β-glucans across membranes with transport rates correlating with ATPase activity.

What are the best animal models for studying the role of NdvA in Bartonella henselae pathogenesis?

Selecting appropriate animal models for studying NdvA's role in pathogenesis requires consideration of natural host-pathogen interactions:

Feline Models:

  • Natural host relevance: Cats are the natural reservoir for B. henselae

  • Laboratory-bred specific pathogen-free (SPF) cats provide a controlled environment for studying bacterial colonization

  • Parameters to monitor:

    • Bacteremia levels over time

    • Bacterial load in lymph nodes and spleen

    • Histopathological changes in tissues

    • Immune response (antibody production, cytokine profiles)

Murine Models:

  • C57BL/6 mice: Useful for studying bacterial dissemination and immune responses

  • SCID mice: Allow assessment of bacterial replication without adaptive immune interference

  • Advantages:

    • Genetic manipulation possibilities

    • Availability of immunological reagents

    • Cost-effectiveness compared to larger animals

  • Limitations:

    • Not the natural host

    • May require immune modulation for successful infection

Cell Culture Models:

  • Human umbilical vein endothelial cells (HUVECs): Model vascular colonization

  • J774 macrophages: Study intracellular survival strategies

  • Feline erythrocytes: Investigate attachment mechanisms

Experimental Approach:

  • Generate ndvA knockout and complemented B. henselae strains

  • Compare wild-type, knockout, and complemented strains for:

    • Colonization efficiency

    • Persistence in tissues

    • Induction of angiogenesis

    • Intracellular survival

    • Host immune response modulation

The impact of NdvA on pathogenesis can be assessed by monitoring differences in bacterial load, tissue pathology, and host immune responses between wild-type and ndvA-deficient strains in these models.

How can structural studies of NdvA inform the development of inhibitors targeting this transporter?

Structural studies of NdvA can guide inhibitor development through these systematic approaches:

Structural Characterization Steps:

  • Obtain high-resolution structures of NdvA in multiple conformational states using:

    • X-ray crystallography for stable conformations

    • Cryo-electron microscopy for conformational ensembles, as demonstrated with Brucella Cgt

    • Nuclear magnetic resonance (NMR) for dynamic regions

  • Identify critical functional sites:

    • ATP binding pocket in nucleotide-binding domains

    • Substrate binding pocket at the cytoplasmic leaflet

    • Transmembrane channel residues

    • Interfaces between protein domains

  • Characterize conformational changes during transport cycle:

    • Map the structural transitions between resting, substrate-bound, ATP-bound, and post-hydrolysis states

    • Identify hinge regions and conserved motifs

Structure-Based Inhibitor Design:

  • Virtual screening approaches:

    • Dock compound libraries against identified binding pockets

    • Perform molecular dynamics simulations to account for protein flexibility

    • Apply pharmacophore-based screening using key interaction points

  • Rational design strategies:

    • Design ATP-competitive inhibitors targeting the nucleotide-binding domains

    • Develop substrate mimetics that block the substrate-binding pocket

    • Create allosteric inhibitors that prevent conformational changes

    • Design interface disruptors that prevent essential domain interactions

  • Fragment-based approaches:

    • Screen fragment libraries against specific pockets

    • Link or grow fragments to increase potency and specificity

Inhibitor Target SiteAdvantagePotential Approach
ATP-binding pocketHighly conserved, well-characterizedATP analogs, adenosine derivatives
Substrate-binding pocketHigher specificity for NdvACyclic β-glucan mimetics
Transmembrane channelDirectly blocks transportPeptidomimetics, small molecules
Allosteric sitesNovel mechanism, potentially higher selectivityScreening for conformational stabilizers

The unusual binding pocket revealed in Cgt at the height of the cytoplasmic leaflet may represent a particularly promising target site for NdvA inhibitors, as this feature might be conserved in related transporters.

What methodologies are most effective for investigating the interaction between NdvA and host cellular components?

To comprehensively investigate NdvA-host interactions, implement these methodologies:

1. Protein-Protein Interaction Studies:

  • Bacterial Two-Hybrid (B2H): Screen for interactions between NdvA and host proteins expressed in bacterial systems

  • Yeast Two-Hybrid (Y2H): Identify potential host protein partners from cDNA libraries

  • Pull-down assays: Use purified His-tagged NdvA as bait to capture interacting host proteins

  • Co-immunoprecipitation: Isolate native protein complexes from infected host cells

  • Proximity labeling (BioID, APEX): Tag proteins in close proximity to NdvA in living cells

2. Microscopy-Based Approaches:

  • Immunofluorescence microscopy: Visualize NdvA localization relative to host structures

  • Förster resonance energy transfer (FRET): Detect direct protein interactions with nanometer resolution

  • Live cell imaging: Track NdvA dynamics during infection using fluorescent protein fusions

  • Super-resolution microscopy: Resolve NdvA distribution at the nanoscale

3. Functional Impact Assessment:

  • siRNA screening: Identify host factors that affect NdvA function

  • CRISPR/Cas9 knockout: Generate host cell lines lacking specific interaction partners

  • Pharmacological inhibition: Use specific inhibitors to block host pathways potentially involved in NdvA function

  • Cyclic β-glucan tracking: Monitor the distribution of labeled CβGs in host cells

4. Structural Studies of Complexes:

  • Cryo-electron microscopy: Determine structures of NdvA in complex with host factors

  • X-ray crystallography: Obtain high-resolution structures of stable complexes

  • Hydrogen-deuterium exchange mass spectrometry: Map interaction interfaces

5. Systems Biology Approaches:

  • Transcriptomics: Analyze host gene expression changes in response to wild-type vs. ndvA-deficient B. henselae

  • Proteomics: Compare host protein abundance and modifications during infection

  • Metabolomics: Assess alterations in host metabolic pathways potentially affected by NdvA-exported CβGs

These methodologies can reveal how NdvA and its transported cyclic β-glucans modulate host cellular processes, providing insights into mechanisms of bacterial pathogenesis and potential therapeutic targets.

How can recombinant NdvA protein be used in the development of diagnostic assays for Bartonella henselae infections?

Recombinant NdvA protein offers significant potential for diagnostic assay development, leveraging approaches demonstrated with other B. henselae proteins:

1. Antibody-Based Detection Systems:

  • Enzyme-Linked Immunosorbent Assay (ELISA): Develop assays using purified recombinant NdvA as the capture antigen to detect anti-NdvA antibodies in patient serum, similar to approaches used with the B. henselae 17-kDa protein and Pap31 protein

  • Western Blot: Use recombinant NdvA for confirmatory testing following ELISA screening

  • Lateral Flow Assays: Create rapid point-of-care tests for field diagnostics

Performance Optimization:

  • Use histidine-tagged recombinant protein purified by nickel-agarose chromatography to ensure high purity

  • Determine optimal antigen concentration (typically 1-5 μg/mL for plate coating)

  • Establish appropriate cutoff values using ROC curve analysis, as done with the B. henselae 17-kDa protein (AUC 0.823) and Pap31 (AUC 0.714)

  • Validate with well-characterized patient sera panels

Diagnostic ParameterB. henselae 17-kDa ProteinB. henselae Pap31Expected for NdvA
Sensitivity71.1% 42% (dogs), 72% (humans) 60-70% (estimated)
Specificity93.0% 94% (dogs), 61% (humans) 85-95% (estimated)
AUC0.823 0.714 (dogs), 0.747 (humans) 0.75-0.85 (estimated)

2. Antigen Detection Methods:

  • Direct ELISA: Develop assays with anti-NdvA antibodies to detect the protein in clinical specimens

  • Immunochromatographic tests: Create rapid assays for antigen detection

  • Mass spectrometry: Identify NdvA-specific peptide signatures in clinical samples

3. Molecular Diagnostic Enhancement:

  • Develop PCR primers targeting the ndvA gene for molecular detection

  • Create multiplex assays combining detection of ndvA with other Bartonella-specific genes like gltA

  • Implement restriction fragment length polymorphism (RFLP) analysis for strain differentiation

4. Advanced Approaches:

  • Aptamer development: Select DNA or RNA aptamers that specifically bind NdvA

  • Biosensor integration: Incorporate recombinant NdvA or anti-NdvA antibodies into electrochemical or optical biosensors

  • Microfluidic platforms: Develop lab-on-a-chip devices for integrated sample processing and detection

Based on experiences with other B. henselae proteins, recombinant NdvA-based assays would likely achieve moderate to high specificity with variable sensitivity, making them valuable components of a comprehensive diagnostic approach.

What strategies can improve the specificity and sensitivity of NdvA-based diagnostic methods?

To enhance the diagnostic performance of NdvA-based assays, implement these evidence-based strategies:

1. Protein Engineering Approaches:

  • Domain-specific analysis: Test individual domains of NdvA to identify regions with higher diagnostic value, similar to the approach used with Pap31 where the N-terminal domain showed superior performance (AUC 0.792 for dogs, 0.747 for humans)

  • Epitope mapping: Identify immunodominant epitopes using peptide arrays or phage display

  • Directed evolution: Generate variant libraries with enhanced antigenicity or stability

2. Assay Optimization:

  • Buffer composition: Test different coating buffers, blocking agents, and detection antibodies

  • Signal amplification: Implement biotin-streptavidin systems or polymeric detection antibodies

  • Incubation conditions: Optimize temperature, time, and agitation parameters

3. Multimarker Approaches:

  • Antigen combinations: Create assays using NdvA together with other B. henselae antigens (17-kDa protein , Pap31 )

  • Multiplex platforms: Develop bead-based or microarray systems detecting antibodies against multiple antigens simultaneously

  • Algorithm development: Implement statistical models combining results from multiple markers

4. Sample Processing Enhancements:

  • Pre-absorption steps: Remove cross-reactive antibodies using heterologous antigens

  • IgM separation: Isolate IgM for acute infection diagnosis

  • Avidity testing: Distinguish recent from past infections by antibody avidity measurement

5. Advanced Detection Methods:

  • Electrochemiluminescence: Increase sensitivity through alternative detection chemistry

  • Single molecule arrays: Apply ultrasensitive digital ELISA platforms

  • Mass spectrometry: Implement immunoprecipitation coupled with MS for precise antigen detection

Enhancement StrategyExpected Impact on SpecificityExpected Impact on Sensitivity
Domain-specific analysis+10-15%Variable
Epitope mapping+15-20%+5-10%
Multimarker approach+15-25%+20-30%
Pre-absorption steps+10-20%Minimal change
Advanced detection methodsMinimal change+25-35%

Based on experiences with the B. henselae 17-kDa protein and Pap31, implementing these strategies could potentially increase diagnostic specificity to >95% and sensitivity to 80-85%, significantly improving upon the performance observed with individual antigens alone .

How can researchers develop inhibitors targeting NdvA as potential therapeutic agents?

Developing NdvA inhibitors as therapeutic agents requires a systematic approach:

1. Target Validation:

  • Create ndvA knockout strains and assess virulence attenuation in infection models

  • Perform complementation studies to confirm phenotype specificity

  • Evaluate the impact of NdvA inhibition on bacterial survival and host cell interaction

2. High-Throughput Screening (HTS):

  • Biochemical assays: Develop ATPase inhibition assays using purified recombinant NdvA

  • Transport assays: Screen for compounds that block cyclic β-glucan transport in reconstituted systems

  • Cell-based screens: Identify compounds that phenocopy ndvA deletion effects in infection models

3. Structure-Based Drug Design:

  • Utilize cryo-EM structures of related transporters like Cgt from Brucella abortus

  • Focus on the unusual binding pocket identified at the cytoplasmic leaflet

  • Apply in silico screening against identified binding sites

  • Design compounds targeting different conformational states of the transport cycle

4. Rational Design Approaches:

  • ATP-competitive inhibitors: Design nucleotide analogs targeting the ATP-binding pocket

  • Substrate mimetics: Create cyclic β-glucan analogs that bind but aren't transported

  • Allosteric inhibitors: Develop compounds that lock the transporter in an inactive conformation

  • Combination approaches: Target both NdvA and enzymes involved in cyclic β-glucan synthesis

5. Lead Optimization:

  • Improve potency, selectivity, and pharmacokinetic properties through medicinal chemistry

  • Test against related ABC transporters from other bacterial species and human ABC transporters

  • Assess effects on commensal bacteria to predict microbiome impact

  • Evaluate resistance development through serial passage experiments

6. Preclinical Evaluation:

  • Determine efficacy in cellular and animal models of B. henselae infection

  • Assess toxicity in mammalian cells and animals

  • Evaluate pharmacokinetics and tissue distribution

  • Test combinations with conventional antibiotics for synergistic effects

Inhibitor ClassAdvantagesChallengesDevelopment Strategy
ATP-competitiveWell-established precedent in kinase inhibitorsPotential cross-reactivity with host ABC transportersFocus on bacterial-specific binding pocket features
Substrate mimeticsHigh specificity for bacterial targetComplex synthesis of cyclic β-glucan analogsSimplify structure while maintaining key recognition elements
Allosteric inhibitorsNovel mechanism, potentially higher selectivityMore difficult to identify binding sitesFragment-based approaches with biophysical confirmation
Covalent inhibitorsExtended target engagementPotential off-target reactivityTarget unique cysteine residues in NdvA

This multifaceted approach leverages structural insights from related transporters while employing both targeted and screening-based strategies to identify compounds that disrupt NdvA function as potential therapeutics against B. henselae infections.

What bioinformatic approaches can identify conserved features in NdvA proteins across Bartonella species for broad-spectrum targeting?

To identify conserved features in NdvA proteins that could enable broad-spectrum therapeutic targeting, implement these bioinformatic approaches:

1. Sequence-Based Analyses:

  • Multiple sequence alignment (MSA): Align NdvA sequences from all available Bartonella species (B. henselae, B. quintana, etc.)

  • Conservation scoring: Calculate per-residue conservation scores using methods like Jensen-Shannon divergence

  • Motif identification: Detect conserved sequence motifs using MEME, GLAM2, or similar tools

  • Selective pressure analysis: Calculate dN/dS ratios to identify functionally constrained regions

2. Structural Bioinformatics:

  • Homology modeling: Generate structural models of NdvA proteins using the Brucella Cgt structure as template

  • Structural alignment: Compare models to identify conserved 3D features not evident from sequence alone

  • Binding pocket analysis: Characterize the substrate binding pocket at the cytoplasmic leaflet described in Cgt

  • Molecular dynamics simulations: Assess conformational flexibility of conserved regions

3. Functional Domain Analysis:

  • Domain architecture comparison: Map nucleotide-binding domains (NBDs) and transmembrane domains (TMDs)

  • ATP-binding site conservation: Analyze Walker A/B motifs and Q-loop, D-loop, H-loop conservation

  • Coupling helix identification: Locate conserved coupling helices that transmit conformational changes between domains

  • Transport pathway mapping: Identify conserved residues lining the substrate translocation pathway

4. Comparative Genomics:

  • Synteny analysis: Examine gene neighborhood conservation across Bartonella species

  • Co-evolution detection: Identify co-evolving residue networks using methods like GREMLIN or EVcouplings

  • Phylogenetic profiling: Correlate NdvA presence/absence with pathogenicity traits

  • Horizontal gene transfer analysis: Assess potential exchange of ndvA genes between species

5. Network-Based Approaches:

  • Protein-protein interaction prediction: Identify conserved interfaces with partner proteins

  • Residue interaction networks: Map conserved communication pathways within the protein structure

  • Allosteric site prediction: Locate conserved allosteric pockets using algorithms like AlloPred

Analysis TypeExpected ConservationTargeting PotentialExample Tools
ATP-binding pocketVery high (>90%)Excellent for broad-spectrumClustal Omega, ConSurf
Substrate-binding pocketModerate (70-80%)Good, with species-specific variationsSiteMap, FTMap
Transmembrane helicesHigh (80-90%)Good for structural inhibitorsTMHMM, HMMTOP
Coupling helicesVery high (>90%)Excellent for allosteric inhibitionDynaMut, CABS-flex
Species-specific regionsLow (<50%)Poor for broad-spectrum, good for specific targetingMUSCLE, T-Coffee

Focusing on the most conserved functional elements across Bartonella species, particularly those involved in ATP binding and hydrolysis or in the unusual substrate binding pocket identified in related transporters , offers the greatest potential for developing broad-spectrum inhibitors targeting NdvA.

How can NdvA research inform the development of vaccines against Bartonella henselae?

NdvA research provides several avenues for B. henselae vaccine development:

1. Antigen Selection Strategies:

  • Whole protein approach: Use purified recombinant NdvA as a subunit vaccine component

  • Epitope identification: Map B-cell and T-cell epitopes within NdvA for epitope-based vaccine design

  • Domain-specific approach: Focus on immunogenic extracellular domains or periplasmic loops

  • Multi-antigen combination: Combine NdvA with other immunogenic proteins like the 17-kDa protein and Pap31

2. Immunogenicity Enhancement:

  • Adjuvant optimization: Test different adjuvants to boost immune responses against NdvA

  • Delivery system development: Incorporate NdvA into liposomes, virus-like particles, or nanoparticles

  • Prime-boost strategies: Combine protein-based and nucleic acid-based (DNA/mRNA) approaches

  • Immune focusing: Modify NdvA to highlight conserved protective epitopes

3. Functional Considerations:

  • Neutralizing antibody induction: Design vaccines targeting functional domains critical for ATP hydrolysis or substrate transport

  • T-cell activation: Ensure inclusion of T-cell epitopes for robust cellular immunity

  • Antibody accessibility: Focus on regions accessible to antibodies in intact bacteria

  • Cross-protection: Identify conserved epitopes across Bartonella species for broader protection

4. Preclinical Evaluation:

  • Animal models: Test in natural host (cats) and models of human infection

  • Correlates of protection: Identify immune markers that correlate with protective efficacy

  • Challenge studies: Evaluate protection against bacterial challenge in appropriate models

  • Safety assessment: Monitor for potential autoimmune reactions or enhancement of infection

Vaccine ApproachAdvantagesChallengesDevelopment Strategy
Recombinant NdvA proteinFull range of epitopes, easier productionPotential conformational issuesExpress with proper folding systems, add stabilizing mutations
NdvA peptide epitopesPrecise immune focusing, simpler manufacturingMay miss conformational epitopesCombine multiple peptides, use structural information to select
DNA/mRNA encoding NdvAIn vivo expression, proper foldingDelivery efficiencyOptimize codon usage, use effective delivery vehicles
Attenuated ΔndvA with complementationNatural presentation, multiple antigensSafety concernsEngineer additional attenuating mutations, tight regulation

Lessons from the immunological assessment of the B. henselae 17-kDa protein and Pap31 indicate that recombinant bacterial proteins can elicit strong antibody responses with diagnostic relevance. This suggests that properly designed NdvA-based vaccines could similarly induce protective immunity against B. henselae infection.

What are the major knowledge gaps in our understanding of NdvA function in Bartonella henselae?

Despite advances in understanding bacterial ABC transporters, significant knowledge gaps remain regarding NdvA in Bartonella henselae:

  • Structural characterization: Unlike Cgt from Brucella abortus , no high-resolution structures of B. henselae NdvA in different conformational states have been determined, limiting our understanding of its specific mechanistic features.

  • Substrate specificity: The exact structural requirements for cyclic β-glucans recognized and transported by B. henselae NdvA remain undefined, including preferences for specific sizes, compositions, or modifications of these polysaccharides.

  • Regulatory mechanisms: The environmental and host signals that modulate ndvA expression during different stages of infection are poorly understood, as are the transcriptional regulators controlling its expression.

  • Interaction network: The protein-protein interactions between NdvA and other bacterial or host components have not been systematically mapped, limiting our understanding of its broader functional context.

  • Contribution to pathogenesis: While cyclic β-glucans are known to be important for host interaction, the specific contribution of NdvA-exported molecules to B. henselae virulence mechanisms remains incompletely characterized.

  • Transport energetics: The precise coupling ratio between ATP hydrolysis and substrate transport, as well as the thermodynamic efficiency of the transport process, requires further investigation.

  • Post-translational modifications: Potential regulatory modifications affecting NdvA function in different environmental conditions have not been characterized.

  • Inhibitor binding sites: Unlike some other bacterial targets, the specific binding sites and modes of action for potential NdvA inhibitors have not been experimentally validated.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.